PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo6G0056200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 405aa    MW: 41981.9 Da    PI: 6.2638
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo6G0056200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.91.2e-39117176261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++k+l+cprC+s+ntkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s
  Spipo6G0056200 117 PDKILPCPRCNSSNTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSS 176
                     7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-29114174IPR003851Zinc finger, Dof-type
PfamPF027014.3E-32119175IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.031121175IPR003851Zinc finger, Dof-type
PROSITE patternPS013610123159IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MREVRDPTLK LFGRAIPVPE AQGEAAEKPG SPAGSAAVED KNASGETVSS EAEAMEFEKR  60
EEEADYSELD ASSTVCCENE DSPKVEEEGE TAMAEPMAGQ GKAKNLKGEG KVALKKPDKI  120
LPCPRCNSSN TKFCYYNNYN VNQPRHFCKN CQRYWTAGGT MRNVPVGAGR RKNKSSALHS  180
RHGGAAKPAA AAAAAVARPA PSGDNAGEPS CASSSLTAST GLEGELLDGE EQAAGVLHGG  240
AAGLPPPPPP PPVHCYPWPV GWNGAAATPA AVPFPLLPAF FWSCMSAWPA SPAWTAAPWA  300
GPSSPAAAPP SSSACTAAGK VAETSSIWVP KTLRIDDPDE AAKSSIWATL GINPDPKIRS  360
GGIFRGFDSK SAAAAADRRP LEGIQAPHVN PAALSRSQAF KEST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922885.12e-88PREDICTED: cyclic dof factor 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.15e-41cycling DOF factor 3